Lineage for d1yu3a2 (1yu3 A:171-380)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002260Family d.169.1.8: Mtd variable domain [143964] (1 protein)
    fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide
  6. 3002261Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species)
  7. 3002262Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries)
    Uniprot Q775D6 171-380
    includes related Bordetella phage proteins
  8. 3002269Domain d1yu3a2: 1yu3 A:171-380 [124032]
    Other proteins in same PDB: d1yu3a1
    complexed with mg

Details for d1yu3a2

PDB Entry: 1yu3 (more details), 2.52 Å

PDB Description: Major Tropism Determinant I1 Variant
PDB Compounds: (A:) Major Tropism Determinant (Mtd-I1)

SCOPe Domain Sequences for d1yu3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu3a2 d.169.1.8 (A:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggswfytsy
sgsraaywnagpsnssanigargvcdhlil

SCOPe Domain Coordinates for d1yu3a2:

Click to download the PDB-style file with coordinates for d1yu3a2.
(The format of our PDB-style files is described here.)

Timeline for d1yu3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yu3a1