![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.163: Pseudo beta-prism I [141657] (1 superfamily) beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges |
![]() | Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families) ![]() found in phage proteins that form trimers, but is not involved in the trimerisation |
![]() | Family b.163.1.1: Mtd domain-like [141659] (1 protein) |
![]() | Protein Major tropism determinant (Mtd), N-terminal domain [141660] (1 species) includes extra N-terminal trimerization domain; beta-alpha-beta(3) |
![]() | Species Bordetella phage bpp-1 [TaxId:194699] [141661] (6 PDB entries) Uniprot Q775D6 5-170 includes other related Bordetella phages |
![]() | Domain d1yu3a1: 1yu3 A:5-170 [124031] Other proteins in same PDB: d1yu3a2 complexed with mg |
PDB Entry: 1yu3 (more details), 2.52 Å
SCOPe Domain Sequences for d1yu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yu3a1 b.163.1.1 (A:5-170) Major tropism determinant (Mtd), N-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]} vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdi
Timeline for d1yu3a1: