Lineage for d1yu2a2 (1yu2 A:171-380)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 738438Family d.169.1.8: Mtd variable domain [143964] (1 protein)
    fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide
  6. 738439Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species)
  7. 738440Species Bordetella phage bpp-1 [TaxId:194699] [143966] (5 PDB entries)
    includes related Bordetella phage proteins
  8. 738442Domain d1yu2a2: 1yu2 A:171-380 [124030]
    Other proteins in same PDB: d1yu2a1
    complexed with mg

Details for d1yu2a2

PDB Entry: 1yu2 (more details), 1.86 Å

PDB Description: Major Tropism Determinant M1 Variant
PDB Compounds: (A:) Major Tropism Determinant (Mtd-M1)

SCOP Domain Sequences for d1yu2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu2a2 d.169.1.8 (A:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggswhytsn
sgsraaywysgpsnspanigargvcdhlil

SCOP Domain Coordinates for d1yu2a2:

Click to download the PDB-style file with coordinates for d1yu2a2.
(The format of our PDB-style files is described here.)

Timeline for d1yu2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yu2a1