Lineage for d1yu0a1 (1yu0 A:5-170)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 681023Fold b.163: Pseudo beta-prism [141657] (1 superfamily)
    beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges
  4. 681024Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families) (S)
    found in phage proteins that form trimers, but is not involved in the trimerisation
  5. 681025Family b.163.1.1: Mtd domain-like [141659] (1 protein)
  6. 681026Protein Major tropism determinant (Mtd), N-terminal domain [141660] (1 species)
    includes extra N-terminal trimerization domain; beta-alpha-beta(3)
  7. 681027Species Bordetella phage bpp-1 [TaxId:194699] [141661] (5 PDB entries)
    includes other related Bordetella phages
  8. 681028Domain d1yu0a1: 1yu0 A:5-170 [124025]
    Other proteins in same PDB: d1yu0a2
    complexed with ca

Details for d1yu0a1

PDB Entry: 1yu0 (more details), 1.56 Å

PDB Description: Major Tropism Determinant P1 Variant
PDB Compounds: (A:) Major Tropism Determinant (Mtd-P1)

SCOP Domain Sequences for d1yu0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu0a1 b.163.1.1 (A:5-170) Major tropism determinant (Mtd), N-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa
vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn
fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdi

SCOP Domain Coordinates for d1yu0a1:

Click to download the PDB-style file with coordinates for d1yu0a1.
(The format of our PDB-style files is described here.)

Timeline for d1yu0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yu0a2