Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) form heterodimeric coiled coil |
Family h.1.25.1: Troponin T [90251] (1 protein) |
Protein Troponin T [90252] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [144262] (2 PDB entries) Uniprot P12620 159-248 |
Domain d1ytzt1: 1ytz T:159-248 [124024] Other proteins in same PDB: d1ytzc1, d1ytzi1 complexed with ca, dr6 |
PDB Entry: 1ytz (more details), 3 Å
SCOPe Domain Sequences for d1ytzt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytzt1 h.1.25.1 (T:159-248) Troponin T {Chicken (Gallus gallus) [TaxId: 9031]} syssylakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyqlqt ekydfaeqikrkkyeivtlrnridqaqkhs
Timeline for d1ytzt1: