SCOPe 2.03: Domain d1ytzt1: 1ytz T:159-248

Lineage for d1ytzt1 (1ytz T:159-248)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families)
   form heterodimeric coiled coil

5. Family h.1.25.1: Troponin T [90251] (1 protein)

6. Protein Troponin T [90252] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [144262] (2 PDB entries)
   Uniprot P12620 159-248

8. Domain d1ytzt1: 1ytz T:159-248 [124024]
   Other proteins in same PDB: d1ytzc1, d1ytzi1
   complexed with ca, dr6

Details for d1ytzt1

PDB Entry: 1ytz, 3 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-activated state

PDB Compounds: (T:) Troponin T

SCOPe Domain Sequences for d1ytzt1:

Sequence; same for both SEQRES and ATOM records:

>d1ytzt1 h.1.25.1 (T:159-248) Troponin T {Chicken (Gallus gallus) [TaxId: 9031]}
syssylakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyqlqt
ekydfaeqikrkkyeivtlrnridqaqkhs

Timeline for d1ytzt1:

• d1ytzt1 first appeared in SCOP 1.73
  
• d1ytzt1 appears in SCOPe 2.02
  
• d1ytzt1 appears in SCOPe 2.04
  
• d1ytzt1 appears in the current release, SCOPe 2.08