Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) form heterodimeric coiled coil |
Family h.1.25.2: Troponin I [90254] (1 protein) |
Protein Troponin I [90255] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [144263] (2 PDB entries) Uniprot P68246 3-118! Uniprot P68246 3-143 |
Domain d1ytzi1: 1ytz I:3-143 [124023] Other proteins in same PDB: d1ytzc_, d1ytzt1 complexed with ca, dr6 |
PDB Entry: 1ytz (more details), 3 Å
SCOPe Domain Sequences for d1ytzi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytzi1 h.1.25.2 (I:3-143) Troponin I {Chicken (Gallus gallus) [TaxId: 9031]} eekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqelqe lskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsadaml rallgskhkvnmdlranlkqv
Timeline for d1ytzi1: