SCOPe 2.03: Domain d1ytzi1: 1ytz I:3-143

Lineage for d1ytzi1 (1ytz I:3-143)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families)
   form heterodimeric coiled coil

5. Family h.1.25.2: Troponin I [90254] (1 protein)

6. Protein Troponin I [90255] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [144263] (2 PDB entries)
   Uniprot P68246 3-118! Uniprot P68246 3-143

8. Domain d1ytzi1: 1ytz I:3-143 [124023]
   Other proteins in same PDB: d1ytzc1, d1ytzt1
   complexed with ca, dr6

Details for d1ytzi1

PDB Entry: 1ytz, 3 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-activated state

PDB Compounds: (I:) troponin I

SCOPe Domain Sequences for d1ytzi1:

Sequence; same for both SEQRES and ATOM records:

>d1ytzi1 h.1.25.2 (I:3-143) Troponin I {Chicken (Gallus gallus) [TaxId: 9031]}
eekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqelqe
lskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsadaml
rallgskhkvnmdlranlkqv

Timeline for d1ytzi1:

• d1ytzi1 first appeared in SCOP 1.73
  
• d1ytzi1 appears in SCOPe 2.02
  
• d1ytzi1 appears in SCOPe 2.04
  
• d1ytzi1 appears in the current release, SCOPe 2.08