Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Troponin C [47503] (6 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries) Uniprot P09860 |
Domain d1ytzc_: 1ytz C: [124022] Other proteins in same PDB: d1ytzi1, d1ytzt1 automated match to d1topa_ complexed with ca, dr6 |
PDB Entry: 1ytz (more details), 3 Å
SCOPe Domain Sequences for d1ytzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytzc_ a.39.1.5 (C:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr atgehvteediedlmkdsdknndgridfdeflkmmegvq
Timeline for d1ytzc_: