![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.46: La domain [101051] (2 proteins) Pfam PF05383; RNA-binding domain |
![]() | Protein Lupus La autoantigen N-terminal domain [101052] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101053] (7 PDB entries) |
![]() | Domain d1ytyb1: 1yty B:7-103 [124020] Other proteins in same PDB: d1ytya2, d1ytyb2 automated match to d1zh5b1 protein/RNA complex |
PDB Entry: 1yty (more details), 2.29 Å
SCOPe Domain Sequences for d1ytyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytyb1 a.4.5.46 (B:7-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} nekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdfn vivealskskaelmeisedktkirrspskplpevtde
Timeline for d1ytyb1: