Lineage for d1ytya2 (1yty A:104-189)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195139Protein Lupus LA protein [89940] (1 species)
  7. 2195140Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)
  8. 2195149Domain d1ytya2: 1yty A:104-189 [124019]
    Other proteins in same PDB: d1ytya1, d1ytyb1
    automated match to d1zh5a2
    protein/RNA complex

Details for d1ytya2

PDB Entry: 1yty (more details), 2.29 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen
PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d1ytya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytya2 d.58.7.1 (A:104-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
ykndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsies
akkfvetpgqkyketdllilfkddyf

SCOPe Domain Coordinates for d1ytya2:

Click to download the PDB-style file with coordinates for d1ytya2.
(The format of our PDB-style files is described here.)

Timeline for d1ytya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ytya1