![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
![]() | Protein Lupus LA protein [89940] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89941] (4 PDB entries) |
![]() | Domain d1ytya2: 1yty A:105-189 [124019] Other proteins in same PDB: d1ytya1, d1ytyb1 automatically matched to d1s79a_ |
PDB Entry: 1yty (more details), 2.29 Å
SCOP Domain Sequences for d1ytya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytya2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa kkfvetpgqkyketdllilfkddyf
Timeline for d1ytya2: