Lineage for d1ytya1 (1yty A:6-103)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.46: La domain [101051] (2 proteins)
    Pfam PF05383; RNA-binding domain
  6. Protein Lupus La autoantigen N-terminal domain [101052] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101053] (7 PDB entries)
  8. Domain d1ytya1: 1yty A:6-103 [124018]
    Other proteins in same PDB: d1ytya2, d1ytyb2
    automated match to d1zh5b1
    protein/RNA complex

Details for d1ytya1

PDB Entry: 1yty (more details), 2.29 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen
PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d1ytya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytya1 a.4.5.46 (A:6-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdf
nvivealskskaelmeisedktkirrspskplpevtde

SCOPe Domain Coordinates for d1ytya1 are not available.

Timeline for d1ytya1:

Domains from same chain:
(mouse over for more information)
d1ytya2
Domains from other chains:
(mouse over for more information)
d1ytyb1, d1ytyb2