SCOPe 2.01: Domain d1ytub1: 1ytu B:93-408

Lineage for d1ytub1 (1ytu B:93-408)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.10: PIWI domain [110640] (3 proteins)
   Pfam PF02171

6. Protein Hypothetical protein AF1318 [142503] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142504] (3 PDB entries)
   Uniprot O28951 11-427

8. Domain d1ytub1: 1ytu B:93-408 [124015]
   automatically matched to 1W9H A:93-408
   protein/RNA complex; complexed with mg

Details for d1ytub1

PDB Entry: 1ytu, 2.5 Å

PDB Description: Structural basis for 5'-end-specific recognition of the guide RNA strand by the A. fulgidus PIWI protein

PDB Compounds: (B:) hypothetical protein af1318

SCOPe Domain Sequences for d1ytub1:

Sequence; same for both SEQRES and ATOM records:

>d1ytub1 c.55.3.10 (B:93-408) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
fdsiksqvdnaidtgvdgimlvlpeyntplyyklksylinsipsqfmrydilsnrnltfy
vdnllvqfvsklggkpwilnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwne
ispivtsseyltylkstikkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketv
eelkkqemvsrdvkyailhlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpyl
krnglemvtpikplsveivsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvn
ypklvagiianvnryg

Timeline for d1ytub1:

• d1ytub1 first appeared in SCOP 1.73
  
• d1ytub1 appears in SCOP 1.75
  
• d1ytub1 appears in SCOPe 2.02
  
• d1ytub1 last appears in SCOPe 2.05