Lineage for d1ytub1 (1ytu B:93-408)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 837319Family c.55.3.10: PIWI domain [110640] (3 proteins)
    Pfam PF02171
  6. 837333Protein Hypothetical protein AF1318 [142503] (1 species)
  7. 837334Species Archaeoglobus fulgidus [TaxId:2234] [142504] (3 PDB entries)
    Uniprot O28951 11-427
  8. 837339Domain d1ytub1: 1ytu B:93-408 [124015]
    automatically matched to 1W9H A:93-408
    complexed with mg

Details for d1ytub1

PDB Entry: 1ytu (more details), 2.5 Å

PDB Description: Structural basis for 5'-end-specific recognition of the guide RNA strand by the A. fulgidus PIWI protein
PDB Compounds: (B:) hypothetical protein af1318

SCOP Domain Sequences for d1ytub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytub1 c.55.3.10 (B:93-408) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]}
fdsiksqvdnaidtgvdgimlvlpeyntplyyklksylinsipsqfmrydilsnrnltfy
vdnllvqfvsklggkpwilnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwne
ispivtsseyltylkstikkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketv
eelkkqemvsrdvkyailhlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpyl
krnglemvtpikplsveivsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvn
ypklvagiianvnryg

SCOP Domain Coordinates for d1ytub1:

Click to download the PDB-style file with coordinates for d1ytub1.
(The format of our PDB-style files is described here.)

Timeline for d1ytub1: