![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.10: PIWI domain [110640] (3 proteins) Pfam PF02171 |
![]() | Protein Hypothetical protein AF1318 [142503] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [142504] (3 PDB entries) |
![]() | Domain d1ytub1: 1ytu B:93-408 [124015] automatically matched to 1W9H A:93-408 complexed with mg |
PDB Entry: 1ytu (more details), 2.5 Å
SCOP Domain Sequences for d1ytub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ytub1 c.55.3.10 (B:93-408) Hypothetical protein AF1318 {Archaeoglobus fulgidus [TaxId: 2234]} fdsiksqvdnaidtgvdgimlvlpeyntplyyklksylinsipsqfmrydilsnrnltfy vdnllvqfvsklggkpwilnvdpekgsdiiigtgatridnvnlfcfamvfkkdgtmlwne ispivtsseyltylkstikkvvygfkksnpdwdvekltlhvsgkrpkmkdgetkilketv eelkkqemvsrdvkyailhlnethpfwvmgdpnnrfhpyegtkvklsskrylltllqpyl krnglemvtpikplsveivsdnwtseeyyhnvheildeiyylskmnwrgfrsrnlpvtvn ypklvagiianvnryg
Timeline for d1ytub1: