Lineage for d1ytqa2 (1ytq A:103-194)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045692Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2045693Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2045694Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2045695Protein beta-Crystallin [49702] (4 species)
    duplication consists of two domains of this fold
  7. 2045707Species Human (Homo sapiens) [TaxId:9606] [101572] (2 PDB entries)
  8. 2045713Domain d1ytqa2: 1ytq A:103-194 [124013]
    automated match to d1okia2

Details for d1ytqa2

PDB Entry: 1ytq (more details), 1.7 Å

PDB Description: Structure of Native Human Beta B2 Crystallin
PDB Compounds: (A:) Beta crystallin B2

SCOPe Domain Sequences for d1ytqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytqa2 b.11.1.1 (A:103-194) beta-Crystallin {Human (Homo sapiens) [TaxId: 9606]}
sqehkiilyenpnftgkkmeiidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglq
yllekgdykdssdfgaphpqvqsvrrirdmqw

SCOPe Domain Coordinates for d1ytqa2:

Click to download the PDB-style file with coordinates for d1ytqa2.
(The format of our PDB-style files is described here.)

Timeline for d1ytqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ytqa1