SCOP 1.73: Domain d1ytqa2: 1ytq A:104-194

Lineage for d1ytqa2 (1ytq A:104-194)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (6 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (4 proteins)

6. Protein beta-Crystallin [49702] (4 species)
   duplication consists of two domains of this fold

7. Species Cow (Bos taurus) [TaxId:9913] [49703] (3 PDB entries)

8. Domain d1ytqa2: 1ytq A:104-194 [124013]
   automatically matched to d1blba2

Details for d1ytqa2

PDB Entry: 1ytq, 1.7 Å

PDB Description: Structure of Native Human Beta B2 Crystallin

PDB Compounds: (A:) Beta crystallin B2

SCOP Domain Sequences for d1ytqa2:

Sequence; same for both SEQRES and ATOM records:

>d1ytqa2 b.11.1.1 (A:104-194) beta-Crystallin {Cow (Bos taurus) [TaxId: 9913]}
qehkiilyenpnftgkkmeiidddvpsfhahgyqekvssvrvqsgtwvgyqypgyrglqy
llekgdykdssdfgaphpqvqsvrrirdmqw

Timeline for d1ytqa2:

• d1ytqa2 is new in SCOP 1.73
  
• d1ytqa2 appears in SCOP 1.75
  
• d1ytqa2 appears in the current release, SCOPe 2.08