SCOPe 2.08: Domain d1ytld_: 1ytl D:

Lineage for d1ytld_ (1ytl D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.6: ACDE2-like [142130] (1 protein)
   Pfam PF02552

6. Protein Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 [142131] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [142132] (1 PDB entry)
   Uniprot O30273 17-174

8. Domain d1ytld_: 1ytl D: [124011]
   automated match to d1ytla1

Details for d1ytld_

PDB Entry: 1ytl, 1.8 Å

PDB Description: Crystal Structure of Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2

PDB Compounds: (D:) Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2

SCOPe Domain Sequences for d1ytld_:

Sequence; same for both SEQRES and ATOM records:

>d1ytld_ c.31.1.6 (D:) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]}
kmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvekditvvatgsaitrfid
aglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyyhgsqmlaaiknfaphi
ralaidryyhpnadmsfgnlwkkeedylklldeilael

Timeline for d1ytld_:

• d1ytld_ first appeared in SCOP 1.73, called d1ytld1
  
• d1ytld_ appears in SCOPe 2.07