Lineage for d1ytlc_ (1ytl C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2863013Family c.31.1.6: ACDE2-like [142130] (1 protein)
    Pfam PF02552
  6. 2863014Protein Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 [142131] (1 species)
  7. 2863015Species Archaeoglobus fulgidus [TaxId:2234] [142132] (1 PDB entry)
    Uniprot O30273 17-174
  8. 2863018Domain d1ytlc_: 1ytl C: [124010]
    automated match to d1ytla1

Details for d1ytlc_

PDB Entry: 1ytl (more details), 1.8 Å

PDB Description: Crystal Structure of Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2
PDB Compounds: (C:) Acetyl-CoA decarboxylase/synthase complex epsilon subunit 2

SCOPe Domain Sequences for d1ytlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytlc_ c.31.1.6 (C:) Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2, ACDE2 {Archaeoglobus fulgidus [TaxId: 2234]}
matllekgkpvanmikkakrpllivgpdmtdemfervkkfvekditvvatgsaitrfida
glgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyyhgsqmlaaiknfaphir
alaidryyhpnadmsfgnlwkkeedylklldeilael

SCOPe Domain Coordinates for d1ytlc_:

Click to download the PDB-style file with coordinates for d1ytlc_.
(The format of our PDB-style files is described here.)

Timeline for d1ytlc_: