SCOPe 2.08: Domain d1ytab_: 1yta B:

Lineage for d1ytab_ (1yta B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Oligoribonuclease [89719] (2 species)

7. Species Escherichia coli [TaxId:562] [142492] (2 PDB entries)
   Uniprot P0A784 1-180

8. Domain d1ytab_: 1yta B: [124003]
   automated match to d1j9aa_
   complexed with flc

Details for d1ytab_

PDB Entry: 1yta, 2.2 Å

PDB Description: Crystal Structure of Oligoribonuclease, the lone essential exoribonuclease in Escherichia coli

PDB Compounds: (B:) Oligoribonuclease

SCOPe Domain Sequences for d1ytab_:

Sequence; same for both SEQRES and ATOM records:

>d1ytab_ c.55.3.5 (B:) Oligoribonuclease {Escherichia coli [TaxId: 562]}
sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl

Timeline for d1ytab_:

• d1ytab_ first appeared in SCOP 1.73, called d1ytab1
  
• d1ytab_ appears in SCOPe 2.07