Lineage for d1ytaa1 (1yta A:1-180)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702422Protein Oligoribonuclease [89719] (2 species)
  7. 702423Species Escherichia coli [TaxId:562] [142492] (1 PDB entry)
  8. 702424Domain d1ytaa1: 1yta A:1-180 [124002]
    complexed with flc

Details for d1ytaa1

PDB Entry: 1yta (more details), 2.2 Å

PDB Description: Crystal Structure of Oligoribonuclease, the lone essential exoribonuclease in Escherichia coli
PDB Compounds: (A:) Oligoribonuclease

SCOP Domain Sequences for d1ytaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytaa1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]}
sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl

SCOP Domain Coordinates for d1ytaa1:

Click to download the PDB-style file with coordinates for d1ytaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ytaa1: