![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (58 PDB entries) |
![]() | Domain d1yt9b_: 1yt9 B: [124001] automated match to d3bhea_ complexed with ois |
PDB Entry: 1yt9 (more details), 3 Å
SCOPe Domain Sequences for d1yt9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yt9b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d1yt9b_: