SCOPe 2.07: Domain d1yt3a2: 1yt3 A:295-375

Lineage for d1yt3a2 (1yt3 A:295-375)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.8: HRDC-like [47819] (5 families)

5. Family a.60.8.3: RNase D C-terminal domains [140643] (1 protein)
   tandem repeat of two domains of this fold, the first domain belongs to Pfam PF00570

6. Protein Ribonuclease D [140644] (1 species)

7. Species Escherichia coli [TaxId:562] [140645] (1 PDB entry)
   Uniprot P09155 194-294! Uniprot P09155 295-375

8. Domain d1yt3a2: 1yt3 A:295-375 [123993]
   Other proteins in same PDB: d1yt3a3
   complexed with so4, zn

Details for d1yt3a2

PDB Entry: 1yt3, 1.6 Å

PDB Description: Crystal Structure of Escherichia coli RNase D, an exoribonuclease involved in structured RNA processing

PDB Compounds: (A:) Ribonuclease D

SCOPe Domain Sequences for d1yt3a2:

Sequence; same for both SEQRES and ATOM records:

>d1yt3a2 a.60.8.3 (A:295-375) Ribonuclease D {Escherichia coli [TaxId: 562]}
lnlmdmpgyrkafkaikslitdvsethkisaellasrrqinqllnwhwklkpqnnlpeli
sgwrgelmaealhnllqeypq

Timeline for d1yt3a2:

• d1yt3a2 first appeared in SCOP 1.73
  
• d1yt3a2 appears in SCOPe 2.06
  
• d1yt3a2 appears in the current release, SCOPe 2.08