Lineage for d1yt2a1 (1yt2 A:73-337)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732553Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 732554Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 732555Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 732556Protein HSP90 [55876] (3 species)
  7. 732575Species Dog (Canis familiaris) [TaxId:9615] [103225] (20 PDB entries)
  8. 732608Domain d1yt2a1: 1yt2 A:73-337 [123991]
    automatically matched to d1qy5a_
    complexed with pg4

Details for d1yt2a1

PDB Entry: 1yt2 (more details), 3.25 Å

PDB Description: crystal structure of the unliganded form of grp94, the er hsp90: basis for nucleotide-induced conformational change, grp94n apo crystal
PDB Compounds: (A:) Endoplasmin

SCOP Domain Sequences for d1yt2a1:

Sequence, based on SEQRES records: (download)

>d1yt2a1 d.122.1.1 (A:73-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
sekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneel
tvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseli
gqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlk
eeasdyleldtiknlvkkysqfinfpiyvwssktetveepmeeeeaakeekedsddeaav
eeeeeekkpktkkvektvwdwelmn

Sequence, based on observed residues (ATOM records): (download)

>d1yt2a1 d.122.1.1 (A:73-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]}
sekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneel
tvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseli
gqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlk
eeasdyleldtiknlvkkysqfinfpiyvwssktektvwdwelmn

SCOP Domain Coordinates for d1yt2a1:

Click to download the PDB-style file with coordinates for d1yt2a1.
(The format of our PDB-style files is described here.)

Timeline for d1yt2a1: