Lineage for d1ysxa1 (1ysx A:389-584)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2009791Family a.126.1.1: Serum albumin-like [48553] (2 protein domains)
  6. 2009792Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 2009793Species Human (Homo sapiens) [TaxId:9606] [48555] (73 PDB entries)
    Uniprot P02768 29-596
  8. 2010092Domain d1ysxa1: 1ysx A:389-584 [123985]
    automatically matched to d1bj5_3
    complexed with 4eb

Details for d1ysxa1

PDB Entry: 1ysx (more details)

PDB Description: Solution structure of domain 3 from human serum albumin complexed to an anti-apoptotic ligand directed against Bcl-xL and Bcl-2
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d1ysxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysxa1 a.126.1.1 (A:389-584) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaalg

SCOPe Domain Coordinates for d1ysxa1:

Click to download the PDB-style file with coordinates for d1ysxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ysxa1: