Lineage for d1ysna2 (1ysn A:5-221)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626689Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 2626690Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries)
  8. 2626781Domain d1ysna2: 1ysn A:5-221 [123980]
    Other proteins in same PDB: d1ysna3
    automated match to d1g5ja_
    complexed with 43b

Details for d1ysna2

PDB Entry: 1ysn (more details)

PDB Description: Solution structure of the anti-apoptotic protein Bcl-xL complexed with an acyl-sulfonamide-based ligand
PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d1ysna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysna2 f.1.4.1 (A:5-221) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh

SCOPe Domain Coordinates for d1ysna2:

Click to download the PDB-style file with coordinates for d1ysna2.
(The format of our PDB-style files is described here.)

Timeline for d1ysna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysna3