SCOPe 2.05: Domain d1ysna_: 1ysn A:

Lineage for d1ysna_ (1ysn A:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (32 PDB entries)

8. Domain d1ysna_: 1ysn A: [123980]
   automated match to d1g5ja_
   complexed with 43b

Details for d1ysna_

PDB Entry: 1ysn

PDB Description: solution structure of the anti-apoptotic protein bcl-xl complexed with an acyl-sulfonamide-based ligand

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d1ysna_:

Sequence; same for both SEQRES and ATOM records:

>d1ysna_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
h

Timeline for d1ysna_:

• d1ysna_ first appeared in SCOP 1.73, called d1ysna1
  
• d1ysna_ appears in SCOPe 2.04
  
• d1ysna_ is called d1ysna2 in SCOPe 2.06
  
• d1ysna_ appears in the current release, SCOPe 2.08, called d1ysna2