Lineage for d1ysma1 (1ysm A:1-55)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980289Superfamily a.2.16: Calcyclin-binding protein-like [140106] (1 family) (S)
  5. 1980290Family a.2.16.1: Siah interacting protein N terminal domain-like [140107] (1 protein)
    Pfam PF09032
  6. 1980291Protein Calcyclin-binding protein, CacyBP [140108] (2 species)
  7. 1980296Species Mouse (Mus musculus) [TaxId:10090] [140110] (1 PDB entry)
    Uniprot Q9CXW3 1-55
  8. 1980297Domain d1ysma1: 1ysm A:1-55 [123979]

Details for d1ysma1

PDB Entry: 1ysm (more details)

PDB Description: NMR Structure of N-terminal domain (Residues 1-77) of Siah-Interacting Protein.
PDB Compounds: (A:) Calcyclin-binding protein

SCOPe Domain Sequences for d1ysma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysma1 a.2.16.1 (A:1-55) Calcyclin-binding protein, CacyBP {Mouse (Mus musculus) [TaxId: 10090]}
masvleelqkdleevkvllekstrkrlrdtltsekskietelknkmqqksqkkpe

SCOPe Domain Coordinates for d1ysma1:

Click to download the PDB-style file with coordinates for d1ysma1.
(The format of our PDB-style files is described here.)

Timeline for d1ysma1: