![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) ![]() |
![]() | Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
![]() | Protein Protein YxeP [143403] (1 species) dimeric protein closely related to IAA-amino acid hydrolase |
![]() | Species Bacillus subtilis [TaxId:1423] [143404] (1 PDB entry) |
![]() | Domain d1ysjb2: 1ysj B:178-292 [123978] Other proteins in same PDB: d1ysja1, d1ysjb1 automatically matched to 1YSJ A:178-292 complexed with ni; mutant |
PDB Entry: 1ysj (more details), 2.4 Å
SCOP Domain Sequences for d1ysjb2:
Sequence, based on SEQRES records: (download)
>d1ysjb2 d.58.19.1 (B:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]} svdrfeivikgkgghasipnnsidpiaaagqiisglqsvvsrnisslqnavvsitrvqag tswnvipdqaemegtvrtfqkearqavpehmrrvaegiaagygaqaefkwfpylp
>d1ysjb2 d.58.19.1 (B:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]} svdrfeivikgkidpiaaagqiisglqnavvsitrvqagtswnvipdqaemegtvrtfqk earqavpehmrrvaegiaagygaqaefkwfpylp
Timeline for d1ysjb2: