SCOP 1.73: Domain d1ysjb2: 1ysj B:178-292

Lineage for d1ysjb2 (1ysj B:178-292)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)

6. Protein Protein YxeP [143403] (1 species)
   dimeric protein closely related to IAA-amino acid hydrolase

7. Species Bacillus subtilis [TaxId:1423] [143404] (1 PDB entry)

8. Domain d1ysjb2: 1ysj B:178-292 [123978]
   Other proteins in same PDB: d1ysja1, d1ysjb1
   automatically matched to 1YSJ A:178-292
   complexed with ni; mutant

Details for d1ysjb2

PDB Entry: 1ysj, 2.4 Å

PDB Description: crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family

PDB Compounds: (B:) protein yxeP

SCOP Domain Sequences for d1ysjb2:

Sequence, based on SEQRES records:

>d1ysjb2 d.58.19.1 (B:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgkgghasipnnsidpiaaagqiisglqsvvsrnisslqnavvsitrvqag
tswnvipdqaemegtvrtfqkearqavpehmrrvaegiaagygaqaefkwfpylp

Sequence, based on observed residues (ATOM records):

>d1ysjb2 d.58.19.1 (B:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgkidpiaaagqiisglqnavvsitrvqagtswnvipdqaemegtvrtfqk
earqavpehmrrvaegiaagygaqaefkwfpylp

Timeline for d1ysjb2:

• d1ysjb2 is new in SCOP 1.73
  
• d1ysjb2 appears in SCOP 1.75
  
• d1ysjb2 appears in the current release, SCOPe 2.08