Lineage for d1ysjb2 (1ysj B:178-292)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954343Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 2954344Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 2954382Protein Protein YxeP [143403] (1 species)
    dimeric protein closely related to IAA-amino acid hydrolase
  7. 2954383Species Bacillus subtilis [TaxId:1423] [143404] (1 PDB entry)
    Uniprot P54955 178-292
  8. 2954385Domain d1ysjb2: 1ysj B:178-292 [123978]
    Other proteins in same PDB: d1ysja1, d1ysjb1
    automated match to d1ysja2
    complexed with ni

Details for d1ysjb2

PDB Entry: 1ysj (more details), 2.4 Å

PDB Description: crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family
PDB Compounds: (B:) protein yxeP

SCOPe Domain Sequences for d1ysjb2:

Sequence, based on SEQRES records: (download)

>d1ysjb2 d.58.19.1 (B:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgkgghasipnnsidpiaaagqiisglqsvvsrnisslqnavvsitrvqag
tswnvipdqaemegtvrtfqkearqavpehmrrvaegiaagygaqaefkwfpylp

Sequence, based on observed residues (ATOM records): (download)

>d1ysjb2 d.58.19.1 (B:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgkidpiaaagqiisglqnavvsitrvqagtswnvipdqaemegtvrtfqk
earqavpehmrrvaegiaagygaqaefkwfpylp

SCOPe Domain Coordinates for d1ysjb2:

Click to download the PDB-style file with coordinates for d1ysjb2.
(The format of our PDB-style files is described here.)

Timeline for d1ysjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysjb1