Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
Protein Protein YxeP [142518] (1 species) |
Species Bacillus subtilis [TaxId:1423] [142519] (1 PDB entry) Uniprot P54955 4-177,293-379 |
Domain d1ysjb1: 1ysj B:3-177,B:293-379 [123977] Other proteins in same PDB: d1ysja2, d1ysjb2 automated match to d1ysja1 complexed with ni |
PDB Entry: 1ysj (more details), 2.4 Å
SCOPe Domain Sequences for d1ysjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ysjb1 c.56.5.4 (B:3-177,B:293-379) Protein YxeP {Bacillus subtilis [TaxId: 1423]} dkafhtrlinmrrdlhehpelsfqevettkkirrwleeeqieildvpqlktgviaeikgr edgpviairadidalpiqeqtnlpfaskvdgtmhacghdfhtasiigtamllnqrraelk gtvrfifqpaeeiaagarkvleagvlngvsaifgmhnkpdlpvgtigvkegplmaXsvqn dgtflnaaseaaarlgyqtvhaeqspggedfalyqekipgffvwmgtngteewhhpaftl deealtvasqyfaelavivleti
Timeline for d1ysjb1: