SCOPe 2.08: Domain d1ysjb1: 1ysj B:3-177,B:293-379

Lineage for d1ysjb1 (1ysj B:3-177,B:293-379)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Protein YxeP [142518] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [142519] (1 PDB entry)
   Uniprot P54955 4-177,293-379

8. Domain d1ysjb1: 1ysj B:3-177,B:293-379 [123977]
   Other proteins in same PDB: d1ysja2, d1ysjb2
   automated match to d1ysja1
   complexed with ni

Details for d1ysjb1

PDB Entry: 1ysj, 2.4 Å

PDB Description: crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family

PDB Compounds: (B:) protein yxeP

SCOPe Domain Sequences for d1ysjb1:

Sequence; same for both SEQRES and ATOM records:

>d1ysjb1 c.56.5.4 (B:3-177,B:293-379) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
dkafhtrlinmrrdlhehpelsfqevettkkirrwleeeqieildvpqlktgviaeikgr
edgpviairadidalpiqeqtnlpfaskvdgtmhacghdfhtasiigtamllnqrraelk
gtvrfifqpaeeiaagarkvleagvlngvsaifgmhnkpdlpvgtigvkegplmaXsvqn
dgtflnaaseaaarlgyqtvhaeqspggedfalyqekipgffvwmgtngteewhhpaftl
deealtvasqyfaelavivleti

Timeline for d1ysjb1:

• d1ysjb1 first appeared in SCOP 1.73
  
• d1ysjb1 appears in SCOPe 2.07