Lineage for d1ysja2 (1ysj A:178-292)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197307Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 2197308Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 2197346Protein Protein YxeP [143403] (1 species)
    dimeric protein closely related to IAA-amino acid hydrolase
  7. 2197347Species Bacillus subtilis [TaxId:1423] [143404] (1 PDB entry)
    Uniprot P54955 178-292
  8. 2197348Domain d1ysja2: 1ysj A:178-292 [123976]
    Other proteins in same PDB: d1ysja1, d1ysjb1
    complexed with ni

Details for d1ysja2

PDB Entry: 1ysj (more details), 2.4 Å

PDB Description: Crystal Structure of Bacillus Subtilis YXEP Protein (APC1829), a Dinuclear Metal Binding Peptidase from M20 Family
PDB Compounds: (A:) protein yxeP

SCOPe Domain Sequences for d1ysja2:

Sequence, based on SEQRES records: (download)

>d1ysja2 d.58.19.1 (A:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgkgghasipnnsidpiaaagqiisglqsvvsrnisslqnavvsitrvqag
tswnvipdqaemegtvrtfqkearqavpehmrrvaegiaagygaqaefkwfpylp

Sequence, based on observed residues (ATOM records): (download)

>d1ysja2 d.58.19.1 (A:178-292) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
svdrfeivikgknsidpiaaagqiisglqnavvsitrvqagtswnvipdqaemegtvrtf
qkearqavpehmrrvaegiaagygaqaefkwfpylp

SCOPe Domain Coordinates for d1ysja2:

Click to download the PDB-style file with coordinates for d1ysja2.
(The format of our PDB-style files is described here.)

Timeline for d1ysja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysja1