Lineage for d1ysja1 (1ysj A:4-177,A:293-379)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703198Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 703308Protein Protein YxeP [142518] (1 species)
  7. 703309Species Bacillus subtilis [TaxId:1423] [142519] (1 PDB entry)
  8. 703310Domain d1ysja1: 1ysj A:4-177,A:293-379 [123975]
    Other proteins in same PDB: d1ysja2, d1ysjb2
    complexed with ni; mutant

Details for d1ysja1

PDB Entry: 1ysj (more details), 2.4 Å

PDB Description: crystal structure of bacillus subtilis yxep protein (apc1829), a dinuclear metal binding peptidase from m20 family
PDB Compounds: (A:) protein yxeP

SCOP Domain Sequences for d1ysja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysja1 c.56.5.4 (A:4-177,A:293-379) Protein YxeP {Bacillus subtilis [TaxId: 1423]}
kafhtrlinmrrdlhehpelsfqevettkkirrwleeeqieildvpqlktgviaeikgre
dgpviairadidalpiqeqtnlpfaskvdgtmhacghdfhtasiigtamllnqrraelkg
tvrfifqpaeeiaagarkvleagvlngvsaifgmhnkpdlpvgtigvkegplmaXsvqnd
gtflnaaseaaarlgyqtvhaeqspggedfalyqekipgffvwmgtngteewhhpaftld
eealtvasqyfaelavivleti

SCOP Domain Coordinates for d1ysja1:

Click to download the PDB-style file with coordinates for d1ysja1.
(The format of our PDB-style files is described here.)

Timeline for d1ysja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysja2