![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins) |
![]() | Protein Protein YxeP [142518] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142519] (1 PDB entry) Uniprot P54955 4-177,293-379 |
![]() | Domain d1ysja1: 1ysj A:4-177,A:293-379 [123975] Other proteins in same PDB: d1ysja2, d1ysjb2 complexed with ni |
PDB Entry: 1ysj (more details), 2.4 Å
SCOPe Domain Sequences for d1ysja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ysja1 c.56.5.4 (A:4-177,A:293-379) Protein YxeP {Bacillus subtilis [TaxId: 1423]} kafhtrlinmrrdlhehpelsfqevettkkirrwleeeqieildvpqlktgviaeikgre dgpviairadidalpiqeqtnlpfaskvdgtmhacghdfhtasiigtamllnqrraelkg tvrfifqpaeeiaagarkvleagvlngvsaifgmhnkpdlpvgtigvkegplmaXsvqnd gtflnaaseaaarlgyqtvhaeqspggedfalyqekipgffvwmgtngteewhhpaftld eealtvasqyfaelavivleti
Timeline for d1ysja1: