SCOPe 2.06: Domain d1ysia2: 1ysi A:5-221

Lineage for d1ysia2 (1ysi A:5-221)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)

8. Domain d1ysia2: 1ysi A:5-221 [123974]
   Other proteins in same PDB: d1ysia3
   automated match to d1g5ja_
   complexed with n3b

Details for d1ysia2

PDB Entry: 1ysi

PDB Description: solution structure of the anti-apoptotic protein bcl-xl in complex with an acyl-sulfonamide-based ligand

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d1ysia2:

Sequence; same for both SEQRES and ATOM records:

>d1ysia2 f.1.4.1 (A:5-221) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh

Timeline for d1ysia2:

• d1ysia2 first appeared in SCOP 1.73, called d1ysia1
  
• d1ysia2 was called d1ysia_ in SCOPe 2.05
  
• d1ysia2 appears in SCOPe 2.07
  
• d1ysia2 appears in the current release, SCOPe 2.08