SCOPe 2.07: Domain d1ysga2: 1ysg A:5-221

Lineage for d1ysga2 (1ysg A:5-221)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries)

8. Domain d1ysga2: 1ysg A:5-221 [123973]
   Other proteins in same PDB: d1ysga3
   automated match to d1g5ja_
   complexed with 4fc, tn1

Details for d1ysga2

PDB Entry: 1ysg

PDB Description: solution structure of the anti-apoptotic protein bcl-xl in complex with "sar by nmr" ligands

PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d1ysga2:

Sequence; same for both SEQRES and ATOM records:

>d1ysga2 f.1.4.1 (A:5-221) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh

Timeline for d1ysga2:

• d1ysga2 first appeared in SCOP 1.73, called d1ysga1
  
• d1ysga2 appears in SCOPe 2.06
  
• d1ysga2 appears in the current release, SCOPe 2.08