Lineage for d1ysga_ (1ysg A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955272Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 1955273Species Human (Homo sapiens) [TaxId:9606] [56857] (32 PDB entries)
  8. 1955319Domain d1ysga_: 1ysg A: [123973]
    automated match to d1g5ja_
    complexed with 4fc, tn1

Details for d1ysga_

PDB Entry: 1ysg (more details)

PDB Description: solution structure of the anti-apoptotic protein bcl-xl in complex with "sar by nmr" ligands
PDB Compounds: (A:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d1ysga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysga_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
h

SCOPe Domain Coordinates for d1ysga_:

Click to download the PDB-style file with coordinates for d1ysga_.
(The format of our PDB-style files is described here.)

Timeline for d1ysga_: