SCOPe 2.03: Domain d1ysfa1: 1ysf A:3-53

Lineage for d1ysfa1 (1ysf A:3-53)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.3: AbrB N-terminal domain-like [54743] (2 proteins)
   dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
   automatically mapped to Pfam PF04014

6. Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [54745] (3 PDB entries)

8. Domain d1ysfa1: 1ysf A:3-53 [123971]
   automatically matched to d1ekta_

Details for d1ysfa1

PDB Entry: 1ysf

PDB Description: the solution structure of the n-domain of the transcription factor abrb

PDB Compounds: (A:) Transition state regulatory protein abrB

SCOPe Domain Sequences for d1ysfa1:

Sequence; same for both SEQRES and ATOM records:

>d1ysfa1 b.129.1.3 (A:3-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

Timeline for d1ysfa1:

• d1ysfa1 first appeared in SCOP 1.73
  
• d1ysfa1 appears in SCOPe 2.02
  
• d1ysfa1 is called d1ysfa_ in SCOPe 2.04
  
• d1ysfa1 appears in the current release, SCOPe 2.08, called d1ysfa_