Lineage for d1ysfa1 (1ysf A:3-53)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 967295Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 967296Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 967324Family b.129.1.3: AbrB N-terminal domain-like [54743] (2 proteins)
    dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
  6. 967329Protein Transcription-state regulator AbrB, the N-terminal DNA recognition domain [54744] (1 species)
  7. 967330Species Bacillus subtilis [TaxId:1423] [54745] (3 PDB entries)
  8. 967333Domain d1ysfa1: 1ysf A:3-53 [123971]
    automatically matched to d1ekta_

Details for d1ysfa1

PDB Entry: 1ysf (more details)

PDB Description: the solution structure of the n-domain of the transcription factor abrb
PDB Compounds: (A:) Transition state regulatory protein abrB

SCOPe Domain Sequences for d1ysfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysfa1 b.129.1.3 (A:3-53) Transcription-state regulator AbrB, the N-terminal DNA recognition domain {Bacillus subtilis [TaxId: 1423]}
mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpn

SCOPe Domain Coordinates for d1ysfa1:

Click to download the PDB-style file with coordinates for d1ysfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ysfa1: