SCOPe 2.07: Domain d1ysea1: 1yse A:368-455

Lineage for d1ysea1 (1yse A:368-455)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.7: CUT domain [116891] (5 proteins)
   Pfam PF02376

6. Protein DNA-binding protein SATB1 [140518] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140519] (1 PDB entry)
   Uniprot Q01826 368-455

8. Domain d1ysea1: 1yse A:368-455 [123970]
   1st CUT domain

Details for d1ysea1

PDB Entry: 1yse

PDB Description: solution structure of the mar-binding domain of satb1

PDB Compounds: (A:) DNA-binding protein SATB1

SCOPe Domain Sequences for d1ysea1:

Sequence; same for both SEQRES and ATOM records:

>d1ysea1 a.35.1.7 (A:368-455) DNA-binding protein SATB1 {Human (Homo sapiens) [TaxId: 9606]}
ntevsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlr
amqnflqlpeaerdriyqdererslnaa

Timeline for d1ysea1:

• d1ysea1 first appeared in SCOP 1.73
  
• d1ysea1 appears in SCOPe 2.06
  
• d1ysea1 appears in the current release, SCOPe 2.08