![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
![]() | Protein Cytosine deaminase [89801] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries) |
![]() | Domain d1ysdb2: 1ysd B:201-358 [123969] Other proteins in same PDB: d1ysdb3 automated match to d1ox7b_ complexed with ca, zn; mutant |
PDB Entry: 1ysd (more details), 1.9 Å
SCOPe Domain Sequences for d1ysdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ysdb2 c.97.1.2 (B:201-358) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mvtggmaskwdqkgmdiayeeallgykeggvpiggclinnkdgsvlgrghnmrfqkgsat lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgek ylqtrghevvvvdderckklmkqfiderpqdwfedige
Timeline for d1ysdb2: