SCOP 1.73: Domain d1ysda1: 1ysd A:3-158

Lineage for d1ysda1 (1ysd A:3-158)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
   strand 5 is parallel to strand 4

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (6 PDB entries)

8. Domain d1ysda1: 1ysd A:3-158 [123968]
   complexed with ca, zn; mutant

Details for d1ysda1

PDB Entry: 1ysd, 1.9 Å

PDB Description: yeast cytosine deaminase double mutant

PDB Compounds: (A:) Cytosine deaminase

SCOP Domain Sequences for d1ysda1:

Sequence; same for both SEQRES and ATOM records:

>d1ysda1 c.97.1.2 (A:3-158) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tggmaskwdqkgmdiayeeallgykeggvpiggclinnkdgsvlgrghnmrfqkgsatlh
geistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvvgenvnfkskgekyl
qtrghevvvvdderckklmkqfiderpqdwfedige

Timeline for d1ysda1:

• d1ysda1 is new in SCOP 1.73
  
• d1ysda1 appears in SCOP 1.75
  
• d1ysda1 appears in the current release, SCOPe 2.08