SCOPe 2.07: Domain d1ysbb2: 1ysb B:201-358

Lineage for d1ysbb2 (1ysb B:201-358)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein Cytosine deaminase [89801] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89802] (7 PDB entries)

8. Domain d1ysbb2: 1ysb B:201-358 [123967]
   Other proteins in same PDB: d1ysbb3
   automated match to d1ox7b_
   complexed with ca, zn; mutant

Details for d1ysbb2

PDB Entry: 1ysb, 1.7 Å

PDB Description: yeast cytosine deaminase triple mutant

PDB Compounds: (B:) Cytosine deaminase

SCOPe Domain Sequences for d1ysbb2:

Sequence; same for both SEQRES and ATOM records:

>d1ysbb2 c.97.1.2 (B:201-358) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtggmaskwdqkgmdiayeeallgykeggvpiggclinnkdgsvlgrghnmrfqkgsat
lhgeistlencgrlegkvykdttlyttlspcdmctgaiimygiprcvigenvnfkskgek
ylqtrghevvvvdderckklmkqfiderpqdwfedige

Timeline for d1ysbb2:

• d1ysbb2 first appeared in SCOP 1.73, called d1ysbb1
  
• d1ysbb2 appears in SCOPe 2.06
  
• d1ysbb2 appears in the current release, SCOPe 2.08