SCOP 1.73: Domain d1ys7b2: 1ys7 B:7-127

Lineage for d1ys7b2 (1ys7 B:7-127)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Transcriptional regulatory protein PrrA, N-terminal domain [142031] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142032] (2 PDB entries)

8. Domain d1ys7b2: 1ys7 B:7-127 [123964]
   Other proteins in same PDB: d1ys7a1, d1ys7b1
   automatically matched to 1YS6 A:7-127
   complexed with act, gol, mg, trs

Details for d1ys7b2

PDB Entry: 1ys7, 1.58 Å

PDB Description: crystal structure of the response regulator protein prra complexed with mg2+

PDB Compounds: (B:) Transcriptional regulatory protein prrA

SCOP Domain Sequences for d1ys7b2:

Sequence; same for both SEQRES and ATOM records:

>d1ys7b2 c.23.1.1 (B:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr
g

Timeline for d1ys7b2:

• d1ys7b2 is new in SCOP 1.73
  
• d1ys7b2 appears in SCOP 1.75
  
• d1ys7b2 appears in the current release, SCOPe 2.08