Lineage for d1ys7b2 (1ys7 B:7-127)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855704Protein Transcriptional regulatory protein PrrA, N-terminal domain [142031] (1 species)
  7. 2855705Species Mycobacterium tuberculosis [TaxId:1773] [142032] (2 PDB entries)
    Uniprot P0A5Z6 7-127
  8. 2855709Domain d1ys7b2: 1ys7 B:7-127 [123964]
    Other proteins in same PDB: d1ys7a1, d1ys7b1
    automated match to d1ys6a2
    protein/DNA complex; complexed with act, gol, mg, trs

Details for d1ys7b2

PDB Entry: 1ys7 (more details), 1.58 Å

PDB Description: crystal structure of the response regulator protein prra complexed with mg2+
PDB Compounds: (B:) Transcriptional regulatory protein prrA

SCOPe Domain Sequences for d1ys7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ys7b2 c.23.1.1 (B:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr
g

SCOPe Domain Coordinates for d1ys7b2:

Click to download the PDB-style file with coordinates for d1ys7b2.
(The format of our PDB-style files is described here.)

Timeline for d1ys7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ys7b1