Lineage for d1ys7a1 (1ys7 A:128-233)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 635945Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 635946Family a.4.6.1: PhoB-like [46895] (5 proteins)
    contains 4-stranded meander beta-sheet in the N-terminal extension
  6. 635970Protein Transcriptional regulatory protein PrrA [140315] (1 species)
  7. 635971Species Mycobacterium tuberculosis [TaxId:1773] [140316] (2 PDB entries)
  8. 635972Domain d1ys7a1: 1ys7 A:128-233 [123961]
    Other proteins in same PDB: d1ys7a2, d1ys7b2
    automatically matched to 1YS6 A:128-233
    complexed with act, gol, mg, trs

Details for d1ys7a1

PDB Entry: 1ys7 (more details), 1.58 Å

PDB Description: crystal structure of the response regulator protein prra complexed with mg2+
PDB Compounds: (A:) Transcriptional regulatory protein prrA

SCOP Domain Sequences for d1ys7a1:

Sequence, based on SEQRES records: (download)

>d1ys7a1 a.4.6.1 (A:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq

Sequence, based on observed residues (ATOM records): (download)

>d1ys7a1 a.4.6.1 (A:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfadtnvvdvfigylrrkleagprllhtvrgvgfvlrmq

SCOP Domain Coordinates for d1ys7a1:

Click to download the PDB-style file with coordinates for d1ys7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ys7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ys7a2