Lineage for d1ys6b2 (1ys6 B:7-127)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691829Protein Transcriptional regulatory protein PrrA, N-terminal domain [142031] (1 species)
  7. 691830Species Mycobacterium tuberculosis [TaxId:1773] [142032] (2 PDB entries)
  8. 691834Domain d1ys6b2: 1ys6 B:7-127 [123960]
    Other proteins in same PDB: d1ys6a1, d1ys6b1
    automatically matched to 1YS6 A:7-127
    complexed with ca, gol

Details for d1ys6b2

PDB Entry: 1ys6 (more details), 1.77 Å

PDB Description: Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis
PDB Compounds: (B:) Transcriptional regulatory protein prrA

SCOP Domain Sequences for d1ys6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ys6b2 c.23.1.1 (B:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr
g

SCOP Domain Coordinates for d1ys6b2:

Click to download the PDB-style file with coordinates for d1ys6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ys6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ys6b1