Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) |
Family c.23.1.1: CheY-related [52173] (25 proteins) |
Protein Transcriptional regulatory protein PrrA, N-terminal domain [142031] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [142032] (2 PDB entries) |
Domain d1ys6b2: 1ys6 B:7-127 [123960] Other proteins in same PDB: d1ys6a1, d1ys6b1 automatically matched to 1YS6 A:7-127 complexed with ca, gol |
PDB Entry: 1ys6 (more details), 1.77 Å
SCOP Domain Sequences for d1ys6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ys6b2 c.23.1.1 (B:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr g
Timeline for d1ys6b2: