SCOP 1.73: Domain d1ys6b1: 1ys6 B:128-233

Lineage for d1ys6b1 (1ys6 B:128-233)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (3 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.1: PhoB-like [46895] (5 proteins)
   contains 4-stranded meander beta-sheet in the N-terminal extension

6. Protein Transcriptional regulatory protein PrrA [140315] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140316] (2 PDB entries)

8. Domain d1ys6b1: 1ys6 B:128-233 [123959]
   Other proteins in same PDB: d1ys6a2, d1ys6b2
   automatically matched to 1YS6 A:128-233
   complexed with ca, gol

Details for d1ys6b1

PDB Entry: 1ys6, 1.77 Å

PDB Description: Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis

PDB Compounds: (B:) Transcriptional regulatory protein prrA

SCOP Domain Sequences for d1ys6b1:

Sequence; same for both SEQRES and ATOM records:

>d1ys6b1 a.4.6.1 (B:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq

Timeline for d1ys6b1:

• d1ys6b1 is new in SCOP 1.73
  
• d1ys6b1 appears in SCOP 1.75
  
• d1ys6b1 appears in the current release, SCOPe 2.08