Lineage for d1ys6a2 (1ys6 A:7-127)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825770Protein Transcriptional regulatory protein PrrA, N-terminal domain [142031] (1 species)
  7. 825771Species Mycobacterium tuberculosis [TaxId:1773] [142032] (2 PDB entries)
    Uniprot P0A5Z6 7-127
  8. 825774Domain d1ys6a2: 1ys6 A:7-127 [123958]
    Other proteins in same PDB: d1ys6a1, d1ys6b1
    complexed with ca, gol

Details for d1ys6a2

PDB Entry: 1ys6 (more details), 1.77 Å

PDB Description: Crystal structure of the response regulatory protein PrrA from Mycobacterium Tuberculosis
PDB Compounds: (A:) Transcriptional regulatory protein prrA

SCOP Domain Sequences for d1ys6a2:

Sequence, based on SEQRES records: (download)

>d1ys6a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr
g

Sequence, based on observed residues (ATOM records): (download)

>d1ys6a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg
vsvvtalramdndvpvcvlsarvddrvagleagaddylvkpfvlaelvarvkallrrrg

SCOP Domain Coordinates for d1ys6a2:

Click to download the PDB-style file with coordinates for d1ys6a2.
(The format of our PDB-style files is described here.)

Timeline for d1ys6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ys6a1