| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
| Family a.4.6.1: PhoB-like [46895] (6 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
| Protein Transcriptional regulatory protein PrrA [140315] (1 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [140316] (2 PDB entries) Uniprot P0A5Z6 128-233 |
| Domain d1ys6a1: 1ys6 A:128-233 [123957] Other proteins in same PDB: d1ys6a2, d1ys6b2 complexed with ca, gol |
PDB Entry: 1ys6 (more details), 1.77 Å
SCOPe Domain Sequences for d1ys6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ys6a1 a.4.6.1 (A:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq
Timeline for d1ys6a1: